DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and Frmd5

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_011237768.1 Gene:Frmd5 / 228564 MGIID:2442557 Length:599 Species:Mus musculus


Alignment Length:570 Identity:110/570 - (19%)
Similarity:182/570 - (31%) Gaps:218/570 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 SRSQTASSTSFEQRDY--VIRELIDTE----------SNYL-DVLTALKTKFMGPLERHLNQDE- 462
            ||..:.||.|.| |:|  .:|.|.|:|          ..|| |:|.           .|||..| 
Mouse     3 SRLMSGSSRSLE-REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLC-----------HHLNLLEK 55

  Fly   463 ----LRLIFP-RIRELVDIHTKFLDKLRES--LTPNAKVKMAQ--------------VFLDFREP 506
                :|.:.| :.|..::.....:.:||..  .|...:||...              |||..:..
Mouse    56 DYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD 120

  Fly   507 FLIYGEFCSLLLGAIDYLADVCKKNQ---IIDQLVQKCERDYNVGKLQLRDILSVPMQRILKYHL 568
             |.:|..             :||.:.   :...::|....||:.||..  :..|...|...|:. 
Mouse   121 -LYHGRL-------------LCKTSDAALLAAYILQAEIGDYDPGKHP--EGYSSKFQFFPKHS- 168

  Fly   569 LLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSICDIHLLQ--NGN 631
              :||.|:.:.:|....|      .....:..:|.:::       .|.::....|.|..:  :||
Mouse   169 --EKLEKKIAEIHKTELS------GQTPATSELNFLRK-------AQTLETYGVDPHPCKDVSGN 218

  Fly   632 GSDL--LQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVK---ALHIKTGDMQYTYRDSHN 691
            .:.|  ..:|.::|.|...:.              |.|.::...   |:|...|     ::|...
Mouse   219 AAFLAFTPFGFVVLQGNKRVH--------------FIKCILFASFTAAIHWAGG-----FKDFST 264

  Fly   692 LADYRVEQSHSRRTIGRDTRFKYQLLLARKSGKTAFTLYLKSEHERDKWRKALTEAMESLEPPGC 756
            :....:..:..       |:.|::       ||| |.||:..:.|                    
Mouse   265 ITPKPLSWNEV-------TKLKFE-------GKT-FYLYVSQKEE-------------------- 294

  Fly   757 QSTDHKMEIYTFDAPT--TCRHCSK-------------------------FLKG-RIHQGYRCKV 793
                 |..|.|:.|||  .|:|..|                         |.|| |.....|   
Mouse   295 -----KKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGR--- 351

  Fly   794 CQISVHKGCISSTGRCKQNPVS------VPPPVCDR-----QLSEFNWFAGNMDRETAAH----- 842
                |.|..:.|:.:.|:.|..      ||...|..     :||..     ...|..|.|     
Mouse   352 ----VAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSV-----PRTRRRAVHISIME 407

  Fly   843 RLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKINQENSGD 892
            .||:.|...:...||    |::|          .|..:.|::.::.:|.:
Mouse   408 GLESLRDSAHSTPVR----SSSH----------GDTFLPHVRSSRADSNE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 40/210 (19%)
PH_Vav 624..753 CDD:269930 22/135 (16%)
PH 641..749 CDD:278594 17/110 (15%)
C1_1 761..804 CDD:278556 16/70 (23%)
SH2_Vav_family 824..934 CDD:198193 15/74 (20%)
SH3 940..993 CDD:302595
Frmd5XP_011237768.1 B41 19..210 CDD:214604 43/233 (18%)
PH-like 191..324 CDD:388408 34/198 (17%)
FA 338..383 CDD:370090 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.