powered by:
Protein Alignment Vav and F48G7.9
DIOPT Version :9
Sequence 1: | NP_001097030.1 |
Gene: | Vav / 32920 |
FlyBaseID: | FBgn0040068 |
Length: | 1001 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503271.1 |
Gene: | F48G7.9 / 185997 |
WormBaseID: | WBGene00018620 |
Length: | 125 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 25/70 - (35%) |
Similarity: | 29/70 - (41%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 761 HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQL 825
||........||.|..|||.:.|...|||||..|:..|||.|.:|...|.....|....:.....
Worm 27 HKFRAAALLQPTCCAFCSKIIYGLGKQGYRCLGCETVVHKKCHASMITCCVYDSSRRSSLASVST 91
Fly 826 SEFNW 830
|..||
Worm 92 STKNW 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.