DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and prx-13

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_495513.1 Gene:prx-13 / 174192 WormBaseID:WBGene00004198 Length:330 Species:Caenorhabditis elegans


Alignment Length:65 Identity:20/65 - (30%)
Similarity:29/65 - (44%) Gaps:21/65 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LSDCQGSHVRELSF----DLALD-----------VVSSTTDGASNAVTPTPESYAR----QSQSP 291
            |.|.|.|:.:||||    .|.:.           :::|..||:...:.|.  :|.|    |||||
 Worm   243 LFDFQASNEQELSFMNGETLRVAPKEEQPRVRGWLLASVADGSRIGLVPI--NYVRIVGKQSQSP 305

  Fly   292  291
             Worm   306  305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
prx-13NP_495513.1 Peroxin-13_N 70..217 CDD:282008
SH3_PEX13_eumet 239..297 CDD:212798 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.