powered by:
Protein Alignment Vav and prx-13
DIOPT Version :9
Sequence 1: | NP_001097030.1 |
Gene: | Vav / 32920 |
FlyBaseID: | FBgn0040068 |
Length: | 1001 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495513.1 |
Gene: | prx-13 / 174192 |
WormBaseID: | WBGene00004198 |
Length: | 330 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 29/65 - (44%) |
Gaps: | 21/65 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 LSDCQGSHVRELSF----DLALD-----------VVSSTTDGASNAVTPTPESYAR----QSQSP 291
|.|.|.|:.:|||| .|.:. :::|..||:...:.|. :|.| |||||
Worm 243 LFDFQASNEQELSFMNGETLRVAPKEEQPRVRGWLLASVADGSRIGLVPI--NYVRIVGKQSQSP 305
Fly 292 291
Worm 306 305
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1291 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.