DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and AgaP_AGAP012304

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_320237.3 Gene:AgaP_AGAP012304 / 1280390 VectorBaseID:AGAP012304 Length:184 Species:Anopheles gambiae


Alignment Length:115 Identity:34/115 - (29%)
Similarity:57/115 - (49%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LRDGVLLCNLVIHLDPSSLDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYD 118
            ||||::||.|:..|:|.::  .:.|...  .||...:||.||.... ..:|:.|.|:|:...||:
Mosquito    45 LRDGLILCKLINKLEPGAV--AKINTSG--GQFKMMENINLFQQAI-KKYGVPDLDVFQTVDLYE 104

  Fly   119 LTNFHRVLITLSKLSQ-CRKVQQLHPDLIGFNLQLSPTE---RSHSDEAI 164
            ..:..:|..|:..|.: |.|    ||:..|..|...|.:   |:.::|.:
Mosquito   105 KKDIAQVTSTIFALGRACYK----HPEFQGPFLGPKPADECKRNFTEEQL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723 24/77 (31%)
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
AgaP_AGAP012304XP_320237.3 SCP1 18..179 CDD:227526 34/115 (30%)
CH 26..123 CDD:237981 25/82 (30%)
Calponin 157..178 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.