DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and sos2

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_002938172.3 Gene:sos2 / 100497015 XenbaseID:XB-GENE-1006170 Length:1333 Species:Xenopus tropicalis


Alignment Length:422 Identity:85/422 - (20%)
Similarity:158/422 - (37%) Gaps:105/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 HTNTKEEEVYQDLCA-------------LHRTSRSQTASSTSFEQRDY-VIRELIDTESNYLD-- 441
            |....::::...:||             :...:.|....|::.|.|.| ::|..|..|..||.  
 Frog   154 HFEITQQDIKVSMCADKVLMDMFDQDDDIGLVALSDEEPSSTGELRYYELVRTEIAGERQYLREL 218

  Fly   442 --VLTALKTKFMGPLERHL-NQDELRLIFPRIRELVDIHTKFLDKLRESL------TPNAKVKMA 497
              ::...:..|:.  .|.| ...::..||..|.::.::..|.|..:.:::      :|:..|  .
 Frog   219 NLIIKVFREAFLS--NRKLFTPTDIETIFSNIMDIHELTVKLLGLIEDTVEMTDESSPHPLV--G 279

  Fly   498 QVFLDFRE--PFLIYGEFCSLLLGA--IDYLADVCKKNQIIDQLVQKCERDYNVGKLQLRDILSV 558
            ..|.|..|  .|..|......:|.:  .::...:..|..:........|......|..|..::.|
 Frog   280 SCFEDLAEEQAFDPYETLSQDILASNYQEHFNTLMSKPSVALHFQSIAEGFKEAVKYVLPRLMLV 344

  Fly   559 PMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEV------------------- 604
            |:...|.|..:|: |::|.|...:|...|::|..|::::...:..:                   
 Frog   345 PVYHCLHYFEVLE-LLQERSEDQEDRECLKQAITALLNLRCSMERIFNKHSPRRRPGEPIWRLYN 408

  Fly   605 -KRDSDHLVI-----IQKVKDSICDIHLLQNGNGSDLLQ-YGRLLLDGEL-HIKA-HEDQKTKLR 660
             :..|.|:.|     |||..||         ..|.|:.| ....:::|.| .:.| ||      |
 Frog   409 RQMRSKHVAIKKMNEIQKNIDS---------WEGKDIGQCCNEFIMEGSLTRVGAKHE------R 458

  Fly   661 YAFVFDKILIMVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTI---GRDTRFKYQLLLARKS 722
            :.|:||.::|..|..|   |..:.   ..:|.|:||:::....|.:   .::...:|        
 Frog   459 HIFLFDGLMISCKMNH---GQSRI---PGYNTAEYRLKEKLIMRKVQINDKEDTSEY-------- 509

  Fly   723 GKTAFTLYLKSEH----------ERDKWRKAL 744
             |.||.|..|.|:          |::.|..||
 Frog   510 -KNAFELLSKDENSIVFAAKTAEEKNNWMAAL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 37/189 (20%)
PH_Vav 624..753 CDD:269930 32/137 (23%)
PH 641..749 CDD:278594 29/119 (24%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
sos2XP_002938172.3 Histone 70..169 CDD:333859 2/14 (14%)
RhoGEF 200..382 CDD:238091 38/186 (20%)
PH_SOS 438..544 CDD:269963 30/124 (24%)
RasGEFN 596..740 CDD:214571
RasGEF 775..1014 CDD:238087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.