DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and stac2

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_002940986.1 Gene:stac2 / 100491407 XenbaseID:XB-GENE-995027 Length:405 Species:Xenopus tropicalis


Alignment Length:264 Identity:67/264 - (25%)
Similarity:104/264 - (39%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGC------------ISSTGR----- 808
            |....:.|.....|..|.:.:.|...||.|||:|:|.||..|            :||:.|     
 Frog   111 HSFHEHVFKKQCPCHLCHQIIVGNSKQGLRCKMCKIGVHLWCSEEVSHQQCLGKMSSSFRRNFSS 175

  Fly   809 ------CKQNPVSVPPPVCDRQLSEFNWFAGNMDRETAAHRLENRRIGTYLLRVRPQGPSTAHET 867
                  .:.:|..:|||....:        |.:|..     .|..|.||.|..:.....|:..|:
 Frog   176 PLLIHETQSSPKEIPPPATGPK--------GKVDPV-----YETLRYGTSLAHLNRSSCSSVSES 227

  Fly   868 MYALSLKTDDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVE-LVSYYERNDLGENFAGLNQSLQ 931
            . ..||...:..::..:.:..:|.:|     .|...|....| .||...|:......||..:   
 Frog   228 P-TRSLSEREERLEDPEGSIRSSEES-----PSHPVFPAETEAAVSEDARSVSSLAAAGRAR--- 283

  Fly   932 WPYKEV----IATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQ 992
               ||:    ...|||.:.|:. .|.|.|:...:|:|:  |..::.||:||.||..|:||..:||
 Frog   284 ---KEISPMYCYVALYKFLPQE-INDLPLQPGDRVMVL--DDSNEDWWKGKCGDRTGFFPANFVQ 342

  Fly   993 EQKL 996
            ..:|
 Frog   343 RVRL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556 15/54 (28%)
SH2_Vav_family 824..934 CDD:198193 21/110 (19%)
SH3 940..993 CDD:302595 20/52 (38%)
stac2XP_002940986.1 C1 111..157 CDD:237996 15/45 (33%)
STAC2_u1 176..290 CDD:374707 27/138 (20%)
SH3_Stac2_C 291..343 CDD:212918 20/54 (37%)
SH3 350..398 CDD:388381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.