DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and prex2

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_031759716.1 Gene:prex2 / 100490424 XenbaseID:XB-GENE-6048678 Length:1603 Species:Xenopus tropicalis


Alignment Length:620 Identity:134/620 - (21%)
Similarity:231/620 - (37%) Gaps:191/620 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 VIRELIDTESNYLDVLTALKTKFMGPL--------ERHLNQDELRLIFPRIRELVDIHTKFLDKL 484
            |:.||:.||.:|:..|..|.:.|...:        ::::.::.::::|..|.:::.:|.:||..:
 Frog    24 VLSELLKTERDYVGTLEFLVSAFFHRMMQYAALKADKNVTEETVKILFSNIEDILAVHKEFLSLI 88

  Fly   485 RESL--TPNAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQLVQKC-----E 542
            .:.|  .|||..::...||.|:|.|.||.|:||....|...|.:: .|.:.:...:..|     .
 Frog    89 EDCLYPEPNALQEVGNCFLRFKERFAIYDEYCSNHEKAQKLLLEI-NKIRTVRTFLLNCMLLGGR 152

  Fly   543 RDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRD 607
            ::.:|   .|...|..|:|||.||.|||.:|:|.|...|.||..:..|.:||..|...|||.||.
 Frog   153 KNTDV---PLEGYLVAPIQRICKYPLLLRELLKRTPKKHSDYVCVVDALQAMKAVCTNINEAKRQ 214

  Fly   608 SDHLVIIQKVKDSICDIHLLQNGNGS-------DLLQYGRLLLDGELHIKAHEDQKTKLRYAFVF 665
            .:.|.::::.:..|      :...||       ::|.:|.||.....:|:.        |..|:|
 Frog   215 MEKLEVLEEWQSHI------EGWEGSSITDTCTEMLMHGVLLKISSGNIQD--------RVFFLF 265

  Fly   666 DKILIMVKALH-------IKTGDMQYTYRDSHNLADYRVE-------QSHSRRTIGRDTRFKYQL 716
            |.:|:..|...       ..|...:|.:|...|.....||       ..||              
 Frog   266 DNLLVYCKRKQRRLKNNKASTDGHRYIFRGRINTEVMEVENVDDGTADFHS-------------- 316

  Fly   717 LLARKSGKTA--------------FTLYLKSEHERDKW----------RKALTEAMESLEPPGCQ 757
                 ||.|.              |....|:..::.:|          ||:|...||  :.....
 Frog   317 -----SGNTVVNGWKIHNTAKNKWFVCMAKTPEDKQEWLEAILKERERRKSLRLGME--QDTWMM 374

  Fly   758 STDHKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCD 822
            .::...::|..    .|:| ...:|.|               |..::|..:|...          
 Frog   375 ISEQGEKLYKM----MCKH-GNLIKDR---------------KKKLTSFPKCFIG---------- 409

  Fly   823 RQLSEF-NWF--AGNMDRETAAHRLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMK 884
               ||| :|.  .|.:.::.     |...:|..||                     ::.:|.|:.
 Frog   410 ---SEFVDWLLEIGEIHKQE-----EGVNLGQALL---------------------ENGIIHHVS 445

  Fly   885 INQENSGDSMLYCLSSRRHFKTIVELVSYYERNDLGENFA-GLN-----QSLQWP---------- 933
            ...:...:.|||      .|:  .:..:|:.||:|.:..: |:.     .||..|          
 Frog   446 DKHQFKSEQMLY------RFR--YDDGTYFPRNELHDVISKGVRLYCRLHSLFTPVIRDKDYHLR 502

  Fly   934 -YKEVI-ATALYDYEPKAGSNQLQLRTDCQVLVIG 966
             ||.|: |..|.|:....|    ..||..:.:::|
 Frog   503 TYKSVVMANKLIDWLIAQG----DCRTREEAIILG 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 55/189 (29%)
PH_Vav 624..753 CDD:269930 32/173 (18%)
PH 641..749 CDD:278594 26/145 (18%)
C1_1 761..804 CDD:278556 6/42 (14%)
SH2_Vav_family 824..934 CDD:198193 23/129 (18%)
SH3 940..993 CDD:302595 6/27 (22%)
prex2XP_031759716.1 RhoGEF 24..209 CDD:395496 54/188 (29%)
PH_Collybistin_ASEF 215..362 CDD:269931 30/179 (17%)
DEP 379..459 CDD:413322 22/144 (15%)
DEP_2_P-Rex 471..563 CDD:239887 15/67 (22%)
PDZ 672..740 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.