DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and plekhg1

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_017949742.1 Gene:plekhg1 / 100488098 XenbaseID:XB-GENE-6050489 Length:1563 Species:Xenopus tropicalis


Alignment Length:525 Identity:124/525 - (23%)
Similarity:224/525 - (42%) Gaps:132/525 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 STSSSSSSLLVSESQRLQRAAAAVYNYRSSMASTEHEYAYIYSEDDE------------KVYED- 365
            |||||:||          |.:...:..|.::||..|  ..::.:|.|            ::..| 
 Frog    70 STSSSASS----------RDSHCSFGSRMTLASNSH--LGLFHQDKEAGAIKLELVPARQISNDD 122

  Fly   366 ---LCYVTFQAKAKP-----EVTTDNIACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSF 422
               :|     .|.:|     |..:|.       :..|..|.|......|::  |...:| :|...
 Frog   123 LHRIC-----TKEQPHGSPREKPSDE-------HQSTQWKAEAKRSIKCSV--TEAVET-TSPKL 172

  Fly   423 EQRDYVIRELIDTESNYLDVLTALKTKFMGPLERHLN--QDELRL---------IFPRIRELVDI 476
            ...|.|::|::.||..|:..|.::       :|.:||  .|:.||         :|..|.::...
 Frog   173 MYVDRVVQEILHTERAYVQDLKSI-------VEDYLNCISDQSRLSLGTEERSALFGNICDIYHF 230

  Fly   477 HTKFLDKLRESLTPNAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQLVQKC 541
            :::.|.:|..  ..|..|.:|:.|:...|.|.||.::|:....::..|.: |.:|:|:.:..:: 
 Frog   231 NSELLQELEN--CDNDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAILTE-CMRNKILAKFFRE- 291

  Fly   542 ERDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKR 606
            .::.....|.|...|..|:||||||||||.::........:.|..:..|.:.|..|:.:||::||
 Frog   292 RQEVLQHSLPLGSYLLKPVQRILKYHLLLHEISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKR 356

  Fly   607 DSDHLVIIQKVKDSICDIHLLQNGNGSDLLQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIM 671
            ..:|.:.:|:::.      ||.|..|.||..||.|:|:|....:..::::|    .|:||::|::
 Frog   357 KHEHDIRLQEIQS------LLTNWKGPDLTSYGELVLEGTFRFQRAKNERT----LFLFDRLLLI 411

  Fly   672 VKALHIKTGDMQYTYRDSH----NLADYRVEQSHSRRTIGRD----TRFKYQLLLARKSGKTAFT 728
            .     |..|..|||: :|    ||....|        |.::    :.|.|      |:.|...|
 Frog   412 T-----KKRDDTYTYK-AHILCCNLMLVEV--------IPKEPLSFSVFHY------KNPKLQHT 456

  Fly   729 LYLKSEHERDKW--------------------RKALTEAMESLEPPGCQST---DHKMEIYTFDA 770
            :..||:.::..|                    ::|:.| |:::..||...|   :.|..:...:.
 Frog   457 VQAKSQQDKRLWILHLKRLILENHPAKIPAKAKQAILE-MDAIHHPGFSYTPEGERKSPLNLKED 520

  Fly   771 PTTCR 775
            ..:||
 Frog   521 LASCR 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 48/185 (26%)
PH_Vav 624..753 CDD:269930 37/156 (24%)
PH 641..749 CDD:278594 28/135 (21%)
C1_1 761..804 CDD:278556 3/15 (20%)
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
plekhg1XP_017949742.1 RhoGEF 176..352 CDD:238091 48/186 (26%)
PH_PLEKHG1_G2_G3 334..479 CDD:270063 44/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.