DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and arhgef4

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_004917856.1 Gene:arhgef4 / 100487089 XenbaseID:XB-GENE-960463 Length:1808 Species:Xenopus tropicalis


Alignment Length:362 Identity:96/362 - (26%)
Similarity:169/362 - (46%) Gaps:27/362 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 TKEEEVYQDLCALHRTSRSQTASSTSFEQRDYVIRELIDTESNYLDVLTALKTKFMGPLERH--- 457
            ||..:..||...:.|  |:....:...:.|..||.|:::||.:|:..|..:...::....:.   
 Frog  1374 TKAGDKEQDSRNVPR--RNGFGQNNKDQMRTNVINEILNTEKHYIKHLKDICEGYIKQCRKRDDM 1436

  Fly   458 LNQDELRLIFPRIRELVDIHTKFLDKLRESLTPNAK--VKMAQVFLDFREPFLIYGEFCSLLLGA 520
            ..:|:|..||..|.|:.....|||..|.:.:..::.  .::...||:::..|.||.|:|:....|
 Frog  1437 FTEDQLWTIFGNIEEIYKFQKKFLKTLEKRINKDSPHLSEIGSCFLEYQTDFQIYSEYCNNHPNA 1501

  Fly   521 IDYLADVCKKNQIIDQLVQKCERDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYR 585
            ...|:.:.|..:.: ...:.|.....:..:.|...|..|:|:|.||.|.|.:|:|.|:..|.||.
 Frog  1502 CTELSKLTKVKKYV-HFFETCRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTNSQHRDYT 1565

  Fly   586 SLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSICDIHLLQNGNGSDLL-QYGRLLLDGELHI 649
            ::|.|.:||.:|::.|||.||..:::..|...:.||      ::..|.|:| :...|:..|||..
 Frog  1566 NVEAALDAMKNVARLINERKRRLENIDKIAHWQSSI------EDWEGEDILARSSELIHSGELTK 1624

  Fly   650 KAHEDQKTKLRYAFVFDKILIMVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDTRFKY 714
            .:|...|.:.|..|:||..::..|. .:...|:.| |:...::.|..|.....    |:|..|..
 Frog  1625 ISHLQPKGQQRIFFLFDHQIVFCKK-DLLRRDILY-YKGKIDMDDMEVLNVED----GKDKDFNI 1683

  Fly   715 QLLLARK-SGKTAFTLYL----KSEHERDKWRKALTE 746
            .:..|.| .||.:..::|    |.|| :.:|.:|..|
 Frog  1684 TVKNAFKLQGKVSEEIHLFLAKKPEH-KQRWLQAFEE 1719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 49/179 (27%)
PH_Vav 624..753 CDD:269930 33/129 (26%)
PH 641..749 CDD:278594 30/111 (27%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
arhgef4XP_004917856.1 SH3_ASEF 1291..1363 CDD:212906
RhoGEF 1404..1583 CDD:279015 49/179 (27%)
PH_Collybistin_ASEF 1588..1727 CDD:269931 36/145 (25%)
PH 1616..1719 CDD:278594 29/109 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.