DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and HS3ST1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_005105.1 Gene:HS3ST1 / 9957 HGNCID:5194 Length:307 Species:Homo sapiens


Alignment Length:284 Identity:119/284 - (41%)
Similarity:169/284 - (59%) Gaps:24/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QLLR---------QQGLRP---SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFFD-- 168
            :|||         :.|:.|   ::.||.|:||||:|.|||||||.:.|||||.||.:||||||  
Human    29 ELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWE 93

  Fly   169 RHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYT 233
            .||..||.||...||::...|:|:||||:||.:.:||:|||.|||:.:||:::|||..|.:||||
Human    94 EHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYT 158

  Fly   234 QA----ASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERL 294
            |.    ..|.......|:....:|..:|   ::..:...:|..:::.||.:|||..:..:.|:||
Human   159 QVFYNHMQKHKPYPSIEEFLVRDGRLNV---DYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRL 220

  Fly   295 IMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAI 359
            |.||..||.:|:.||.|...:...:||||.||||.||..|   ....||.::|||.||.:||..:
Human   221 IRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDS---GRDRCLHESKGRAHPQVDPKLL 282

  Fly   360 ERLREFYRPFNNKFYQLTGINFAW 383
            .:|.|::...|.||::|.|..|.|
Human   283 NKLHEYFHEPNKKFFELVGRTFDW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 107/242 (44%)
HS3ST1NP_005105.1 Sulfotransfer_1 54..291 CDD:279075 107/242 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.