DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and HS3ST2

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_006034.1 Gene:HS3ST2 / 9956 HGNCID:5195 Length:367 Species:Homo sapiens


Alignment Length:370 Identity:184/370 - (49%)
Similarity:239/370 - (64%) Gaps:33/370 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SRSLAIALVICVTLVYFSYSFNACLLASISRSLQQSNLRNLLALTSSPR-------------NET 78
            :|.|..|..:.::..|..||| .|....:.||          .|..:||             .::
Human    17 ARRLLFAFTLSLSCTYLCYSF-LCCCDDLGRS----------RLLGAPRCLRGPSAGGQKLLQKS 70

  Fly    79 NNAANSSSSNSSSSRNSSSTTGAPPAQTVTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSG 143
            .....|..:.|..|..|:.....|..:...|:..|:||.         .::.||..||:||||.|
Human    71 RPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKL---------GTKRLPQALIVGVKKGG 126

  Fly   144 TRALLEFIRLHPDVRAAGSEVHFFDRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRV 208
            |||:|||||:||||||.|:|.|||||:|.|||.|||..||.|:|.|||:|||||||||:|.|:|:
Human   127 TRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRI 191

  Fly   209 YHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARY 273
            ::|:..|||::|||:|||||||||||..|||.|:..||.|:|.|.:..:||.:|..::||:|..:
Human   192 FNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRTLGLVDVSWNAIRIGMYVLH 256

  Fly   274 LERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARS 338
            ||.||.||||:|:.|:||||||.|||.|:||||||||:||.:|:||||||.|||||||.|:|:..
Human   257 LESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSL 321

  Fly   339 TPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            .|.||||:|||.|..|||..|::|||||||:|.|||:..|.:|.|
Human   322 LPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 153/236 (65%)
HS3ST2NP_006034.1 cytoplasmic domain 1..19 0/1 (0%)
transmembrane domain 20..41 7/21 (33%)
sulfotransferase domain 110..367 162/257 (63%)
Sulfotransfer_1 114..351 CDD:395556 153/236 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 344 1.000 Domainoid score I1052
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 379 1.000 Inparanoid score I2072
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 1 1.000 - - FOG0000744
OrthoInspector 1 1.000 - - otm41484
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10605
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.