DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and NDST3

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_016864328.1 Gene:NDST3 / 9348 HGNCID:7682 Length:899 Species:Homo sapiens


Alignment Length:292 Identity:95/292 - (32%)
Similarity:138/292 - (47%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PPAQTVTSSLDGAP-KYQLLRQQGLRPSRH------------LPDTLIIGVKKSGTRALLEFIRL 153
            ||.|......:..| :...|.|......||            ||..|:||.:|:||.||..|:.:
Human   553 PPVQLAHKYFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALYLFLVM 617

  Fly   154 HPDVRAAG------SEVHFFDR-HYQRGLRWYRHHMPYTIEGQIT----MEKTPSYFVTKEVPQR 207
            ||.:.:..      .||.||:| :|.||:.||....|  :...:|    .||:.:||.::|.|:|
Human   618 HPSILSNSPSPKTFEEVQFFNRNNYHRGIDWYMDFFP--VPSNVTTDFLFEKSANYFHSEEAPKR 680

  Fly   208 VYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGP-------- 264
            ...:.|..|::.::.||..||.|.|....|.:....|  :.:|    |.|:..  ||        
Human   681 AASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAAL--KFSF----YEVISA--GPRAPSELRA 737

  Fly   265 -----VKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLG-LKRVVTEKHFYFN 323
                 :..|.||.::||||:|||..|||.|.|::|..|||..:..||.||| |......:...|:
Human   738 LQKRCLVPGWYASHIERWLVYFPPFQLLIIDGQQLRTDPATVMDEVQKFLGVLPHYNYSEALTFD 802

  Fly   324 ATKGFPCLFKSEARSTPHCLGKTKGRNHPHID 355
            :.|||.|....|.::  .||||:|||.:|.:|
Human   803 SHKGFWCQLLEEGKT--KCLGKSKGRKYPPMD 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 87/250 (35%)
NDST3XP_016864328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.