DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and NDST2

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_003626.1 Gene:NDST2 / 8509 HGNCID:7681 Length:883 Species:Homo sapiens


Alignment Length:267 Identity:78/267 - (29%)
Similarity:133/267 - (49%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LPDTLIIGVKKSGTRALLEFIRLHPDVRAA------GSEVHFFDR-HYQRGLRWYRHH--MPYTI 186
            ||..||:|.:|:||.|:..|:.|||.|.::      ..|:.||:. :|.:|:.||...  :|...
Human   603 LPKFLIVGPQKTGTTAIHFFLSLHPAVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNA 667

  Fly   187 EGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFV 251
            ......||:.:||.::.||:|...:.|..|::.|:.:|..||.|.|....:..      :.:|..
Human   668 STDFLFEKSATYFDSEVVPRRGAALLPRAKIITVLTNPADRAYSWYQHQRAHG------DPVALN 726

  Fly   252 NGSYSVVD-TNWGPVKI----------GVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRV 305
            ...|.|:. ::..|:.:          |.|:.:|:|||.|:|..|||.:.|:.|..:||..:..:
Human   727 YTFYQVISASSQTPLALRSLQNRCLVPGYYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESI 791

  Fly   306 QDFLGLKRVVT-EKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPF 369
            |.|||:...:. .:...|:..|||.|......::  .|||::|||.:|.:|..:...|.:|:|..
Human   792 QKFLGITPFLNYTRTLRFDDDKGFWCQGLEGGKT--RCLGRSKGRRYPDMDTESRLFLTDFFRNH 854

  Fly   370 NNKFYQL 376
            |.:..:|
Human   855 NLELSKL 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 75/257 (29%)
NDST2NP_003626.1 HSNSD 25..514 CDD:314871
Heparan sulfate N-deacetylase 2 41..597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..81
Heparan sulfate N-sulfotransferase 2 598..883 78/267 (29%)
Sulfotransfer_1 603..852 CDD:307022 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.