DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_445843.2 Gene:Hs3st1 / 84406 RGDID:71084 Length:312 Species:Rattus norvegicus


Alignment Length:289 Identity:118/289 - (40%)
Similarity:170/289 - (58%) Gaps:24/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GAPKYQLLRQQGLRP------------SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVH 165
            |..:.:|||:..:.|            ::.||.|:||||:|.|||||||.:.|||||.||.:|||
  Rat    29 GLKQQELLRKVIILPEDTGEGAATNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVH 93

  Fly   166 FFD--RHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRA 228
            |||  .||.:||.||...||::...|:|:||||:||.:.:||:|::.|||..:||:::|||..|.
  Rat    94 FFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERV 158

  Fly   229 ISDYTQA----ASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFI 289
            :|||||.    ..|.......|.|...:|..:|   ::..:...:|..::..||.:|||..:..:
  Rat   159 LSDYTQVLYNHLQKHKPYPPIEDLLMRDGRLNV---DYKALNRSLYHAHMLNWLRFFPLGHIHIV 220

  Fly   290 SGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHI 354
            .|:|||.||..||.:|:.||.|...:...:||||.||||.||..|   ....||.::|||.||.:
  Rat   221 DGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDS---GKDRCLHESKGRAHPQV 282

  Fly   355 DPGAIERLREFYRPFNNKFYQLTGINFAW 383
            ||..:::|.|::...|.||::|.|..|.|
  Rat   283 DPKLLDKLHEYFHEPNKKFFKLVGRTFDW 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 106/242 (44%)
Hs3st1NP_445843.2 Sulfotransfer_1 59..296 CDD:395556 106/242 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.