DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and ndst2b

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_005156429.1 Gene:ndst2b / 798226 ZFINID:ZDB-GENE-100430-2 Length:893 Species:Danio rerio


Alignment Length:262 Identity:87/262 - (33%)
Similarity:133/262 - (50%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LPDTLIIGVKKSGTRALLEFIRLHPDVRAA------GSEVHFFD-RHYQRGLRWYRHH--MPYTI 186
            ||..|:||.:|:||.||..|:.|||.:.::      ..||.||. .:||||:.||...  :|..:
Zfish   613 LPKFLVIGPQKTGTTALHSFLSLHPAISSSYPSPITFEEVQFFSGPNYQRGIDWYMDFFPVPSNV 677

  Fly   187 EGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKL---FEQL 248
            ......||:.:||.|:..|:|...:.|..|::.::.:|..||.|.|....:.:..:.|   |:::
Zfish   678 STDFLFEKSANYFDTETAPKRAAALLPRAKIISILINPADRAYSWYQHQRAHQDPVALNHTFDEV 742

  Fly   249 --AFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGL 311
              |..:...|::..:...::.|.|:.:|||||.::..||||.:.|.:|...||..:..:|.||| 
Zfish   743 VSAAPSSPASLLSLHRRCLQPGAYSSHLERWLHHYQPSQLLIVDGVQLRSGPAQVMDAIQKFLG- 806

  Fly   312 KRVVTEKHFYFNAT--------KGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRP 368
               ||.   |||.|        |||.|......||  .||||:|||.:|.:...:...|.|:||.
Zfish   807 ---VTP---YFNYTQALMFDESKGFWCQKLEAGRS--RCLGKSKGRKYPDMSLESRAFLSEYYRE 863

  Fly   369 FN 370
            .|
Zfish   864 QN 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 85/258 (33%)
ndst2bXP_005156429.1 HSNSD 25..524 CDD:314871
Sulfotransfer_1 613..864 CDD:307022 86/259 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.