DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st6

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001102920.1 Gene:Hs3st6 / 684979 RGDID:1584381 Length:342 Species:Rattus norvegicus


Alignment Length:283 Identity:174/283 - (61%)
Similarity:207/283 - (73%) Gaps:4/283 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 APPAQTVTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVH 165
            ||......|...|||...:....|   .|..|..||:||||.||||||||:||||||||.|||.|
  Rat    63 APAEPPQASRRLGAPGLPVASGPG---RRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGSEPH 124

  Fly   166 FFDRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAIS 230
            ||||.|.|||.|||..||.|::||||||||||||||:|.|:|::.|:|.|||::|||:|||||||
  Rat   125 FFDRCYDRGLAWYRGLMPRTLDGQITMEKTPSYFVTQEAPRRIHDMSPDTKLIVVVRNPVTRAIS 189

  Fly   231 DYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLI 295
            ||.|..||...:..|..|||.:| ...|||.|..|:||:||::|:.||.|||||..||:|||||:
  Rat   190 DYAQTLSKTPGLPSFRALAFRHG-LGPVDTAWSAVRIGLYAQHLDNWLRYFPLSHFLFVSGERLV 253

  Fly   296 MDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIE 360
            .|||.|:||||||||||||||:||||||||||||||.|::....|.||||:|||.||.:....::
  Rat   254 SDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGSGRPRCLGKSKGRPHPRVPEAVVQ 318

  Fly   361 RLREFYRPFNNKFYQLTGINFAW 383
            ||:.||||||.||||:||.:|.|
  Rat   319 RLQAFYRPFNRKFYQMTGQDFGW 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 154/236 (65%)
Hs3st6NP_001102920.1 Sulfotransfer_1 91..326 CDD:279075 154/235 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354129
Domainoid 1 1.000 332 1.000 Domainoid score I1101
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 368 1.000 Inparanoid score I2073
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 1 1.000 - - FOG0000744
OrthoInspector 1 1.000 - - otm45601
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X411
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.