DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and SULT2B1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_814444.1 Gene:SULT2B1 / 6820 HGNCID:11459 Length:365 Species:Homo sapiens


Alignment Length:208 Identity:50/208 - (24%)
Similarity:86/208 - (41%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFFDRHYQRGLR-WYRHHMPYTIEGQITM-EKT 195
            |..||...||||..::|.|.|   :...|      |..:.|.:. |.|.....||.|..:: ::.
Human    62 DIFIITYPKSGTTWMIEIICL---ILKEG------DPSWIRSVPIWERAPWCETIVGAFSLPDQY 117

  Fly   196 PSYFVTKEVPQRVY---HMNPATKLLIVVRDP--VTRAISDYTQAASKKADMKLFEQLAFVNGSY 255
            ....::..:|.:::   ..:...|::.:.|:|  |..::..|::.|.:..|....:|.       
Human   118 SPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQF------- 175

  Fly   256 SVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLG-------LKR 313
             :.|...|.|:.|.:..:::.||........|||:.|.|..|....:.|:..|||       |..
Human   176 -LRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGS 239

  Fly   314 VVTEKHFYFNATK 326
            ||.  |..|:|.|
Human   240 VVA--HSTFSAMK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 50/208 (24%)
SULT2B1NP_814444.1 Sulfotransfer_1 60..305 CDD:366246 50/208 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.