DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and NDST4

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_072091.1 Gene:NDST4 / 64579 HGNCID:20779 Length:872 Species:Homo sapiens


Alignment Length:272 Identity:92/272 - (33%)
Similarity:135/272 - (49%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 HLPDTLIIGVKKSGTRALLEFIRLHPDVRA------AGSEVHFFD-RHYQRGLRWYRHHM--PYT 185
            |||..|:||.:|:||.||..|:.:||.:.:      ...||.||: .:|.:|:.||....  |..
Human   593 HLPKFLVIGPQKTGTTALYLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSN 657

  Fly   186 IEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAF 250
            .......||:.:||.::|.|:|...:.|..|::.::.||..||.|.|....|.:      :..|.
Human   658 TTSDFLFEKSANYFHSEEAPRRAASLVPKAKIITILIDPSDRAYSWYQHQRSHE------DPAAL 716

  Fly   251 VNGSYSVVDT-NWGPVKI----------GVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGR 304
            ....|.|:.| :|.|..:          |.||.::||||.||..||||.|.|::|..|||..:..
Human   717 RFNFYEVISTGHWAPSDLKTLQRRCLVPGWYAVHIERWLTYFATSQLLIIDGQQLRSDPATVMDE 781

  Fly   305 VQDFLGLKRVVTEKHFY-----FNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLRE 364
            ||.|||    ||.::.|     |:..|||.|......::  .||||:|||.:|.:||.:...|..
Human   782 VQKFLG----VTPRYNYSEALTFDPQKGFWCQLLEGGKT--KCLGKSKGRKYPPMDPESRTFLSN 840

  Fly   365 FYRPFNNKFYQL 376
            :||..|.:..:|
Human   841 YYRDHNVELSKL 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 88/261 (34%)
NDST4NP_072091.1 HSNSD 20..505 CDD:288882
Heparan sulfate N-deacetylase 4 36..588
Heparan sulfate N-sulfotransferase 4 589..872 92/272 (34%)
Sulfotransfer_1 594..845 CDD:279075 89/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.