DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and dctn4

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001025673.1 Gene:dctn4 / 595065 XenbaseID:XB-GENE-491837 Length:470 Species:Xenopus tropicalis


Alignment Length:162 Identity:33/162 - (20%)
Similarity:60/162 - (37%) Gaps:25/162 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VTLVYFSYSFNACLLASIS-RSLQQSNLRNLLALTSSPRNETNNAANSSSSNSSSSRNSSSTTGA 101
            :.||..||.....:::..: |.:::|.:  ||.||:...|.|:..............||::....
 Frog   305 IQLVALSYVPEVRIMSIPNLRYMKESQV--LLTLTNPVENLTHVNLLPCEEGDQDEINSTAKVIV 367

  Fly   102 PPAQTVTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHF 166
            |..:.:.:..|.|.:|..|.:    |.....|..::..:|:....:  ||::.|........|.|
 Frog   368 PNKELILAGKDAAAEYDELAE----PQDFQDDPDVVAFRKANKVGV--FIKVSPLQEKGKVIVSF 426

  Fly   167 FDRHYQRGLR----------------WYRHHM 182
            ..:|..|.|.                |..||:
 Frog   427 KLKHDFRNLAAPIRPLEDNESSSEAVWLTHHV 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 13/68 (19%)
dctn4NP_001025673.1 Dynactin_p62 23..>339 CDD:368474 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.