DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001074062.1 Gene:hs3st1 / 565201 ZFINID:ZDB-GENE-070202-1 Length:293 Species:Danio rerio


Alignment Length:301 Identity:112/301 - (37%)
Similarity:177/301 - (58%) Gaps:28/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SSRNSSSTTG--APPAQTVTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRL 153
            |:::|...:|  :||...:|...:               :|||||.:||||:|:|||||::.:||
Zfish    12 STQSSVLVSGVISPPDAALTPRAN---------------ARHLPDIIIIGVRKAGTRALIQMLRL 61

  Fly   154 HPDVRAAGSEVHFF--DRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATK 216
            |..:.||.:|||||  |.||:|||.||...||....|::|:||||:||.:::||||:....|..:
Zfish    62 HTSIAAAQNEVHFFDWDSHYERGLDWYVDQMPEAQPGRLTVEKTPAYFTSRDVPQRIRLAKPDAR 126

  Fly   217 LLIVVRDPVTRAISDYTQA----ASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERW 277
            ||::||:|..|.:|||||.    ..|:...:..|.|...||.   ::.::.|:...:|..:::||
Zfish   127 LLLIVREPTERLLSDYTQVYHNRLEKRKRPQPLETLLLRNGE---LNLDYKPLNRSLYHTHMQRW 188

  Fly   278 LLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHC 342
            |..||:|....:.|:.|:.:|..|:.:|:.||.|:..:::.:||||.|:||.||  .:.|....|
Zfish   189 LQAFPISSFHLVDGDALVREPLAEMQKVEAFLKLQPQISQNNFYFNQTRGFFCL--RDGRQQQRC 251

  Fly   343 LGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            |..:|||.||.:.|..:.:|:.|:...|.:|::|.|..|.|
Zfish   252 LHSSKGRKHPQVSPHILSKLQHFFHEPNRRFFELVGRTFDW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 98/242 (40%)
hs3st1NP_001074062.1 Sulfotransfer_1 39..277 CDD:304426 98/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.