DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st1l2

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001035015.1 Gene:hs3st1l2 / 562344 ZFINID:ZDB-GENE-070202-3 Length:303 Species:Danio rerio


Alignment Length:282 Identity:109/282 - (38%)
Similarity:160/282 - (56%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFF--DR 169
            |||:....|......|:       ||..:||||:|.|||||||.:.|||||..|.:|:|:|  |.
Zfish    33 VTSATPSGPSNASTLQR-------LPGAIIIGVRKGGTRALLEMLNLHPDVEVAKTEIHYFNLDE 90

  Fly   170 HYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQ 234
            ::::||.|||..||.|:.||:|:||||.||.....|:|::.||||.|||:::|||..|.:|||||
Zfish    91 NFRKGLDWYRSQMPITLPGQLTVEKTPGYFTAPPAPRRIWAMNPAVKLLLIIRDPAERLVSDYTQ 155

  Fly   235 AASKKADM-KLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDP 298
            ....:... |.::.|..:..|...::..:..::...|.::|.|||..||..|:..:.||.||.:|
Zfish   156 VLHNRIQQNKPYQSLEELLLSQGHINPKYKALQRSFYYQHLARWLELFPREQIHIVDGEALIRNP 220

  Fly   299 AYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPH--CLGKTKGRNHPHIDPGAIER 361
            ..|:.:.:.||.|...:...:||||.||||.|:.     |..|  ||.::|||.|..:...|.::
Zfish   221 FPELQKAETFLELPPQIKPDNFYFNVTKGFYCML-----SAGHDKCLDESKGRPHAPLSNEAFQK 280

  Fly   362 LREFYRPFNNKFYQLTGINFAW 383
            |..:.|..|..|:::.|..|.|
Zfish   281 LCRYLRVPNQIFFRMVGQRFDW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 98/241 (41%)
hs3st1l2NP_001035015.1 Sulfotransfer_1 54..285 CDD:279075 96/235 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.