DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st1l1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001074908.1 Gene:hs3st1l1 / 557111 ZFINID:ZDB-GENE-070202-2 Length:309 Species:Danio rerio


Alignment Length:292 Identity:117/292 - (40%)
Similarity:170/292 - (58%) Gaps:26/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GAPPAQTVTSSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEV 164
            |.|...:||.||...|          ..|:|.|.::||||:|.|||||||.:.:||:|.||.:||
Zfish    35 GDPSNDSVTPSLIPPP----------GSSKHPPHSIIIGVRKGGTRALLEMLDIHPEVAAAATEV 89

  Fly   165 HFF--DRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTR 227
            |||  |.:|.:|..|||..|||:...|||:||||.||.::..|.|::.||.:.:||:::|||..|
Zfish    90 HFFDWDENYSKGFDWYREQMPYSYPTQITIEKTPGYFTSQVAPARIHAMNSSIRLLLILRDPTER 154

  Fly   228 AISDYTQAASKKAD----MKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLF 288
            .||||||....:.:    ::..|.:...||:   ::|.:..::..:|..::..||.:|||.|:..
Zfish   155 VISDYTQVYFNRLENHKPVQAIENMLVKNGA---LNTRYKAIQRSLYDVHMRNWLQHFPLEQIHI 216

  Fly   289 ISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPH--CLGKTKGRNH 351
            :.|:.||.||..|:.||:.||.|...:...:||||.||||.|:     ||..|  ||.::|||.|
Zfish   217 VDGDTLIHDPLPELQRVERFLDLPPRIEASNFYFNQTKGFYCI-----RSDGHERCLHESKGRPH 276

  Fly   352 PHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            |.::...:.:||.:.|..|..||:|.|..|.|
Zfish   277 PPVNSNVLRQLRSYLRQHNRNFYRLIGRTFNW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 100/244 (41%)
hs3st1l1NP_001074908.1 Sulfotransfer_1 56..258 CDD:279075 87/204 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.