DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and sfl

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster


Alignment Length:322 Identity:95/322 - (29%)
Similarity:146/322 - (45%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 APPAQTVTSSLDGAPKYQLLRQQGLRP--------SRH------------LPDTLIIGVKKSGTR 145
            |||.|.       |..|..|..:.:.|        .||            ||..|:||.:|:||.
  Fly   715 APPVQL-------AEMYFRLHPEEVDPVWGNPCDDVRHKKIWSKTKNCDSLPKFLVIGPQKTGTT 772

  Fly   146 ALLEFIRLHPDVRA------AGSEVHFFD-RHYQRGLRWY-----RHHMPYTIEGQIT------- 191
            ||..|:.:|..:.:      ...||.||: .:|.|||.||     ...:|.|.....|       
  Fly   773 ALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLPNTSSPMPTQLGSPRF 837

  Fly   192 -MEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKK---ADMKLFEQLAFVN 252
             .||:.:||..:.||:|.:.:.|..|::.::..|..||.|.|....|..   |:...|.|:...:
  Fly   838 MFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGDVIANNYSFYQVITAS 902

  Fly   253 GS--YSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVV 315
            .|  .::.|.....:..|.||::||.||.|:|..||..|.||:|.::|...:..:|.||.::.::
  Fly   903 DSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPIDVMNELQRFLKIQPLL 967

  Fly   316 T-EKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQL 376
            . ..|..::..|||.|...||.|:  .||||:|||.:|.:|..:.:.|:.:|...|....:|
  Fly   968 DYSNHLRYDVKKGFYCQAVSEKRN--KCLGKSKGRQYPAMDERSAKLLQRYYLNHNTALVKL 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 83/262 (32%)
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 82/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10605
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.