DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st6

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001012402.1 Gene:Hs3st6 / 328779 MGIID:3580487 Length:342 Species:Mus musculus


Alignment Length:286 Identity:175/286 - (61%)
Similarity:210/286 - (73%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PAQTVTSSLDGAPKYQLLRQQGLRPS-----RHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGS 162
            ||:...:||       .||..||..:     |..|..||:||||.||||||||:||||||||.||
Mouse    64 PAEPPHTSL-------RLRAPGLPVASGPGRRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGS 121

  Fly   163 EVHFFDRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTR 227
            |.|||||.|.|||.|||..||.|::||||||||||||||:|.|:|::.|:|.|||::|||:||||
Mouse   122 EPHFFDRCYDRGLAWYRGLMPRTLDGQITMEKTPSYFVTQEAPRRIHGMSPDTKLIVVVRNPVTR 186

  Fly   228 AISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGE 292
            |||||.|..||...:..|..|||.:| ...|||.|..|:||:||::|:.||.|||||..||:|||
Mouse   187 AISDYAQTLSKTPGLPSFRALAFRHG-LGPVDTAWSAVRIGLYAQHLDNWLRYFPLSHFLFVSGE 250

  Fly   293 RLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPG 357
            ||:.|||.|:||||||||||||||:||||||||||||||.|::....|.||||:|||.||.:...
Mouse   251 RLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGSGRPRCLGKSKGRPHPRVPEA 315

  Fly   358 AIERLREFYRPFNNKFYQLTGINFAW 383
            .::||:.||||||.||||:||.:|.|
Mouse   316 VVQRLQAFYRPFNRKFYQMTGQDFGW 341

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 154/236 (65%)
Hs3st6NP_001012402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..75 4/17 (24%)
Sulfotransfer_1 91..326 CDD:279075 154/235 (66%)
Substrate binding. /evidence=ECO:0000250 122..128 4/5 (80%)
Substrate binding. /evidence=ECO:0000250 153..156 2/2 (100%)