DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Ndst3

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001178645.1 Gene:Ndst3 / 295430 RGDID:1310960 Length:873 Species:Rattus norvegicus


Alignment Length:317 Identity:101/317 - (31%)
Similarity:150/317 - (47%) Gaps:58/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PPAQTVTSSLDGAP-KYQLLRQQGLRPSRH------------LPDTLIIGVKKSGTRALLEFIRL 153
            ||||......:..| :...|.|......||            ||..|:||.:|:||.||..|:.:
  Rat   553 PPAQLAHKYFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALCLFLIM 617

  Fly   154 HPDVRA------AGSEVHFFDR-HYQRGLRWYRHHMPYTIEGQIT----MEKTPSYFVTKEVPQR 207
            ||.:.:      :..||.||:| :|.||:.||....|  :...:|    .||:.:||.::|.|:|
  Rat   618 HPSILSNSPSPKSFEEVQFFNRNNYHRGIDWYMDFFP--VPSNVTTDFLFEKSANYFHSEEAPKR 680

  Fly   208 VYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGP-------- 264
            ...:.|..|::.::.||..||.|.|....|.:....|  :.:|    |.|:..  ||        
  Rat   681 AASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAAL--KFSF----YEVISA--GPNAPWELRT 737

  Fly   265 -----VKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFY--- 321
                 :..|.||.::||||:|||..|||.|.|::|...||..:..||.|||    |:..:.|   
  Rat   738 LQKRCLVPGWYASHIERWLVYFPPFQLLIIDGQQLRTAPATVMDEVQKFLG----VSPHYNYSEA 798

  Fly   322 --FNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQL 376
              |::.|||.|....|.::  .||||:|||.:|.:|..:...|..:||..|.:..:|
  Rat   799 LTFDSHKGFWCQLLEEGKT--KCLGKSKGRKYPPMDSDSRAFLSSYYRDHNVELSKL 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 89/265 (34%)
Ndst3NP_001178645.1 HSNSD 20..506 CDD:288882
Sulfotransfer_1 595..846 CDD:279075 90/266 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.