DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st5

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099862.1 Gene:Hs3st5 / 294449 RGDID:1306379 Length:346 Species:Rattus norvegicus


Alignment Length:287 Identity:127/287 - (44%)
Similarity:179/287 - (62%) Gaps:27/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SSLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFF--DRHY 171
            ||.:....:.|::|        ||..:||||:|.|||||||.:.|||.|..|..|:|||  |.:|
  Rat    76 SSKEQVRLHDLVQQ--------LPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENY 132

  Fly   172 QRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAA 236
            .:|:.|||..||::...|||:||:|:||:|:|||:|:|.||.:.|||::||:|.|||||||||..
  Rat   133 AKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLMIVREPTTRAISDYTQVL 197

  Fly   237 S----KKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMD 297
            .    |......||:|| ::.:...|:|.:..|:..:|.::|||||.|||:.|...:.|:|||.:
  Rat   198 EGKERKNKTYYKFEKLA-IDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITE 261

  Fly   298 PAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCL-----FKSEARSTPHCLGKTKGRNHPHIDPG 357
            |..|:..|:.||.|...:::.:.|||||:||.||     |..       ||..:|||.||.:||.
  Rat   262 PLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNK-------CLAGSKGRIHPEVDPS 319

  Fly   358 AIERLREFYRPFNNKFYQLTGINFAWP 384
            .:.:||:|:.|||.||||:||....||
  Rat   320 VVTKLRKFFHPFNQKFYQITGRTLNWP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 112/247 (45%)
Hs3st5NP_001099862.1 Sulfotransfer_1 90..330 CDD:279075 112/247 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.