DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st2

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_006507527.1 Gene:Hs3st2 / 195646 MGIID:1333802 Length:384 Species:Mus musculus


Alignment Length:296 Identity:173/296 - (58%)
Similarity:218/296 - (73%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SSSSRNSSSTTGAPPAQTVTSSLDGAPKYQLLRQQGLRP-SRHLPDTLIIGVKKSGTRALLEFIR 152
            |..|..|:....||..:...|:..|:||          | ::.||..||:||||.||||:|||||
Mouse    98 SEPSAPSAPAAAAPAPRLSGSNHSGSPK----------PGTKRLPQALIVGVKKGGTRAVLEFIR 152

  Fly   153 LHPDVRAAGSEVHFFDRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKL 217
            :||||||.|:|.|||||:|.|||.|||..||.|:|.|||:|||||||||:|.|:|:::|:..|||
Mouse   153 VHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLETQITLEKTPSYFVTQEAPRRIFNMSRDTKL 217

  Fly   218 LIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFP 282
            ::|||:|||||||||||..|||.|:..||.|:|.|.|..:||.:|..::||:||.:||.||.|||
Mouse   218 IVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRSLGLVDVSWNAIRIGMYALHLESWLRYFP 282

  Fly   283 LSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTK 347
            |:|:.|:||||||.|||.|:||:|||||:||.:|:||||||.|||||||.|.|:...|.||||:|
Mouse   283 LAQIHFVSGERLITDPAGEMGRIQDFLGIKRFITDKHFYFNKTKGFPCLKKPESTLLPRCLGKSK 347

  Fly   348 GRNHPHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            ||.|..|||..|::|||||||:|.|||:..|.:|.|
Mouse   348 GRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRW 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 154/236 (65%)
Hs3st2XP_006507527.1 Sulfotransfer_1 131..368 CDD:366246 154/236 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 337 1.000 Domainoid score I1108
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 369 1.000 Inparanoid score I2120
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 1 1.000 - - FOG0000744
OrthoInspector 1 1.000 - - otm43534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10605
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.