DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hst-1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_501491.4 Gene:hst-1 / 177675 WormBaseID:WBGene00002028 Length:852 Species:Caenorhabditis elegans


Alignment Length:283 Identity:79/283 - (27%)
Similarity:139/283 - (49%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PKYQLLRQQGLRPS-----RHLPDTLIIGVKKSGTRALLEFIRLHPD------VRAAGSEVHFF- 167
            |::..:    |.||     :.|||.||||.:|:|:.||..|:.|||:      |..:..||.|| 
 Worm   565 PRHHAI----LPPSINCTKKSLPDLLIIGPQKTGSTALASFLSLHPNTSQNTPVPGSFEEVQFFG 625

  Fly   168 DRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDY 232
            .::|.:|:.||..:.|.:  ..:|.||:.:||.....|::...:.|..|::|::::|..||.|.:
 Worm   626 GQNYLKGVEWYMSNFPSS--STVTFEKSATYFDNPSAPKQAASLVPHAKIVIILQNPAQRAYSWF 688

  Fly   233 TQAASKKADMKLFEQLAFVNGSYSVV-DTNWGPVKI--------GVYARYLERWLLYFPLSQLLF 288
            ....:.:      :.:|...||..|: |:|....|.        |.|..:|.:||.:|.|.|::|
 Worm   689 QHILAHE------DPVAITAGSLEVILDSNSTSSKKVRQRCISGGRYVHHLTKWLEHFSLQQMIF 747

  Fly   289 ISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPC-LFKSEARSTPHCLGKTKGRNHP 352
            :..:.|.|.|...:..:..:|.|.....|.:..::.:|||.| |...:.:    |||::|||.:|
 Worm   748 VDSDELKMKPPTVLNSLSKWLDLPEFPFETYIRYSPSKGFHCRLLDGKTK----CLGESKGRKYP 808

  Fly   353 HIDPGAIERLREFYRPFNNKFYQ 375
            .:......:|.:.:...|:..|:
 Worm   809 EMPENLRRKLDKIFSLDNSALYK 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 73/253 (29%)
hst-1NP_501491.4 HSNSD 18..491 CDD:288882
Sulfotransfer_1 582..822 CDD:304426 73/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.