DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Ndst1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001335029.1 Gene:Ndst1 / 15531 MGIID:104719 Length:882 Species:Mus musculus


Alignment Length:327 Identity:92/327 - (28%)
Similarity:139/327 - (42%) Gaps:78/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PPAQTVTSSLDGAPKY-QL-------LRQQGLRPSRH------------LPDTLIIGVKKSGTRA 146
            ||.|.       |.|| |:       |.|......||            .|..||||.:|:||.|
Mouse   562 PPVQL-------AQKYFQIFSEEKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTA 619

  Fly   147 LLEFIRLHPDVRA------AGSEVHFFDRH-YQRGLRWYRHHMPYTIEGQIT----MEKTPSYFV 200
            |..|:.:|||:.:      ...|:.||:.| |.:|:.||....|  |....|    .||:.:||.
Mouse   620 LYLFLGMHPDLSSNYPSSETFEEIQFFNGHNYHKGIDWYMEFFP--IPSNTTSDFYFEKSANYFD 682

  Fly   201 TKEVPQRVYHMNPATKLLIVVRDPVTRAISDY--------------------TQAASKKADMKLF 245
            ::..|:|...:.|..|:|.::.:|..||.|.|                    |......:.::..
Mouse   683 SEVAPRRAAALLPKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRAL 747

  Fly   246 EQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLG 310
            :....|.|        |       ||.::||||..|..:|:|.:.|:.|..:||..:..||.|||
Mouse   748 QNRCLVPG--------W-------YATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLG 797

  Fly   311 LKRVVT-EKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFY 374
            :...|. .|...|:..|||.|......::  .||||:|||.:|.:|..:...|::::|..|.:..
Mouse   798 VTSTVDYHKTLAFDPKKGFWCQLLEGGKT--KCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELS 860

  Fly   375 QL 376
            :|
Mouse   861 KL 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 78/268 (29%)
Ndst1NP_001335029.1 HSNSD 30..515 CDD:403326
Heparan sulfate N-deacetylase 1 40..598 11/42 (26%)
Heparan sulfate N-sulfotransferase 1 599..882 81/283 (29%)
Sulfotransfer_1 605..855 CDD:395556 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.