DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_034604.1 Gene:Hs3st1 / 15476 MGIID:1201606 Length:311 Species:Mus musculus


Alignment Length:289 Identity:117/289 - (40%)
Similarity:170/289 - (58%) Gaps:24/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GAPKYQLLRQQGLRP------------SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVH 165
            |..:.:|||:..:.|            ::.||.|:||||:|.|||||||.:.|||||.||.:|||
Mouse    28 GLKQQELLRKVIILPEDTGEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVH 92

  Fly   166 FFD--RHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRA 228
            |||  .||.:||.||...||::...|:|:||||:||.:.:||:|::.|||..:||:::|||..|.
Mouse    93 FFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERV 157

  Fly   229 ISDYTQA----ASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFI 289
            :|||||.    ..|.......|.|...:|.   ::.::..:...:|..::..||.:|||..:..:
Mouse   158 LSDYTQVLYNHLQKHKPYPPIEDLLMRDGR---LNLDYKALNRSLYHAHMLNWLRFFPLGHIHIV 219

  Fly   290 SGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHI 354
            .|:|||.||..||.:|:.||.|...:...:||||.||||.||..|   ....||.::|||.||.:
Mouse   220 DGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDS---GKDRCLHESKGRAHPQV 281

  Fly   355 DPGAIERLREFYRPFNNKFYQLTGINFAW 383
            ||..:::|.|::...|.||::|.|..|.|
Mouse   282 DPKLLDKLHEYFHEPNKKFFKLVGRTFDW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 105/242 (43%)
Hs3st1NP_034604.1 Sulfotransfer_1 58..295 CDD:366246 105/242 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.