DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and Hs3st4

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_017445955.2 Gene:Hs3st4 / 108349781 RGDID:11422907 Length:449 Species:Rattus norvegicus


Alignment Length:446 Identity:203/446 - (45%)
Similarity:252/446 - (56%) Gaps:96/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AATSAQPAMIVMSIWCSSLSLSSRSLAIALVICVTLVYFSYSFNACLLASISRSLQQSNLRNLLA 69
            |:|...||               |.|.....:.:::.|..||     |...|.|||..     ||
  Rat    26 ASTKGPPA---------------RKLLFMCTLSLSVTYLCYS-----LLGGSGSLQFP-----LA 65

  Fly    70 LTSSPRNETNNAANSSSS-------------NSSSSRNSSSTTG---APPAQTVTSSLDG----- 113
            |...|    .:||....|             .:||....:::.|   .||.:..|.:.||     
  Rat    66 LQEPP----GSAAEPPPSLPPPSLPPPGVRPGASSPPPDNASRGPPPEPPERFTTPAADGWGLAS 126

  Fly   114 -------------APKYQLLRQ-----------------QGLRPS----------------RHLP 132
                         ||...:..|                 :|.|.:                :.||
  Rat   127 GGGARDAWPRSPPAPGDAVTEQDALLGRGAQELGAAEELEGRRAANGSAERGPASTPDYGEKKLP 191

  Fly   133 DTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFFDRHYQRGLRWYRHHMPYTIEGQITMEKTPS 197
            ..|||||||.|||||||.||:||||||.|.|.|||||:|::||.|||:.||.|::||||||||||
  Rat   192 QALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYRNVMPKTLDGQITMEKTPS 256

  Fly   198 YFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVVDTNW 262
            ||||.|.|:|::.|....||::|||:|||||||||||..|||.::..||.|||.|.:..::|.:|
  Rat   257 YFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASW 321

  Fly   263 GPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKG 327
            ..::||:||.:||.||.||||||:||:||||||:|||.|:.:|||||||||||||||||||.|||
  Rat   322 SAIRIGIYALHLENWLQYFPLSQILFVSGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKG 386

  Fly   328 FPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            ||||.|.|..|.|.||||:|||.||.|||..|.|||:||:|||..|||:||.:|.|
  Rat   387 FPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNMMFYQMTGQDFQW 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 159/236 (67%)
Hs3st4XP_017445955.2 Sulfotransfer_1 190..427 CDD:395556 159/236 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.