DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st2

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_002932036.2 Gene:hs3st2 / 100492586 XenbaseID:XB-GENE-980910 Length:399 Species:Xenopus tropicalis


Alignment Length:413 Identity:184/413 - (44%)
Similarity:247/413 - (59%) Gaps:45/413 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRDTAATSAQPAMIVMSIWCSSLSLSSRSLAIALVICVTLVYFSYSFNACLLASISRSLQQSNL- 64
            |.::.|....|......::..:|.||      ..::|..|:..|:|.......|...|..||:: 
 Frog     1 MYNSMAPRLSPRRARKYLFVCTLCLS------CTLLCYNLILRSHSSMHSRDQSSMNSRDQSSMQ 59

  Fly    65 ----------------RNLL--------ALTSSPRNETNNAANSSSSNSSSSRNSSSTTGAP--P 103
                            :.||        :.|::|.:........|.....:....:..|.||  |
 Frog    60 QGYEQLSCPLPHLIGSKKLLQKIPPCPHSATTAPPSSAPLTHTVSDIQGKNQTEPTQVTRAPSKP 124

  Fly   104 AQTVTS---SLDGAPKYQLLRQQGLRPSRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVH 165
            .:..||   :....|:|         ..:.||..:|:||||.||||:|||||:||.|||.|:|.|
 Frog   125 TEQPTSPPWNCTATPRY---------GQKRLPQAIIVGVKKGGTRAVLEFIRVHPQVRAMGTEPH 180

  Fly   166 FFDRHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAIS 230
            ||||:|:|||.|||:.||.:::.|||:|||||||||::.|:|:.||:|..||::|||:|||||||
 Frog   181 FFDRNYERGLDWYRNLMPRSLDQQITVEKTPSYFVTRDAPRRIAHMSPRVKLIVVVRNPVTRAIS 245

  Fly   231 DYTQAASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLI 295
            ||||..|||.|:..|.:|||.|.:...|||.|..::||:||.:|:.||.:||:||:.|:||||||
 Frog   246 DYTQTLSKKPDIPSFNELAFRNRTSGEVDTAWNAIRIGLYALHLQPWLSHFPISQMHFVSGERLI 310

  Fly   296 MDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIE 360
            .|||.|:.||||||||||:||:||||||.|||||||.|......|.||||:|||.|..|:|..||
 Frog   311 TDPAGEMARVQDFLGLKRLVTDKHFYFNRTKGFPCLKKPGGGGAPRCLGKSKGRTHVQINPEDIE 375

  Fly   361 RLREFYRPFNNKFYQLTGINFAW 383
            :||:||||.|.|||:..|.:|.|
 Frog   376 QLRDFYRPHNIKFYETVGQDFHW 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 148/236 (63%)
hs3st2XP_002932036.2 Sulfotransfer_1 146..384 CDD:279075 149/237 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.