DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and prdm14

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_002937124.2 Gene:prdm14 / 100490605 XenbaseID:XB-GENE-954695 Length:536 Species:Xenopus tropicalis


Alignment Length:405 Identity:78/405 - (19%)
Similarity:130/405 - (32%) Gaps:138/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LQQSNLRNLLALTSSPRNETNN----AANSSSSNSSSSRNSSS--TTGAPPAQTVTSSLDGAPKY 117
            |..|...|:||......|...:    ..|||.....:.|:..:  |...||.....:.|.||  |
 Frog    35 LPTSQYMNILATPHEMFNPLKSLGRLVTNSSHLGPFNFRDLPALLTQSLPPNDAQVNPLLGA--Y 97

  Fly   118 QLLRQQGLRPSRHLP----DTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFFDRHYQRGLRWY 178
            .:|.:  ::|.  :|    |:|      |..||      .||.                      
 Frog    98 SILTK--VQPP--VPYSQQDSL------SAIRA------SHPS---------------------- 124

  Fly   179 RHHMPYTIEGQITMEKTPSYFV---TKEV-PQRVYHMNPATKLLIVV-----------RDPVTRA 228
               .|..::..|..:|..|..:   :.|| |.|.||........::.           :..||.|
 Frog   125 ---SPEKLKSPIVPKKCKSASLSLPSLEVRPSRTYHFTEEDLQTVLYGYTCGSDSRRSQQTVTHA 186

  Fly   229 ISD--YTQAASKKADMKLFEQ--LAFVNGSYSVVDTNWGPV-KIGVYARYL-ERWLLYFPL-SQL 286
            :|.  ...|.|...|..:.::  |....| .:|:||::|.: |.||:.:.| .:...:.|. .::
 Frog   187 LSGLRIPTACSTGLDSHILDRDSLQLPEG-LTVLDTSYGTLPKAGVFCKNLIPKGAKFGPFQGKV 250

  Fly   287 LFIS-----GERLIMDPAYEIGRVQDFL----------------------GLKRVVTEKHFYFNA 324
            :..|     |:..:|...::.||:..|:                      .|..:..|...|:.:
 Frog   251 VHPSEIKTYGDNSLMWEIFDEGRLSHFIDGKGAAGNWMSRVNCARFPEEQNLIALQCEGEIYYES 315

  Fly   325 TK--------------------GFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLR------ 363
            .|                    |.|...|.        ||:.:....|..:|.|.|..:      
 Frog   316 CKEILPGQELLVWYGDSYLQFLGIPLSLKG--------LGEGRPPYQPTEEPAAAEGYKCERCGK 372

  Fly   364 -EFYRPFNNKFYQLT 377
             ..||.:.:|..:.|
 Frog   373 VFAYRYYRDKHLKYT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 56/316 (18%)
prdm14XP_002937124.2 PR-SET_PRDM14 210..342 CDD:380975 23/132 (17%)
C2H2 Zn finger 399..418 CDD:275368
zf-C2H2 426..448 CDD:333835
C2H2 Zn finger 428..448 CDD:275368
SFP1 <445..529 CDD:227516
C2H2 Zn finger 456..476 CDD:275368
zf-H2C2_2 469..493 CDD:372612
C2H2 Zn finger 484..505 CDD:275368
C2H2 Zn finger 513..533 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.