DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st3a1

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_002941135.1 Gene:hs3st3a1 / 100380167 XenbaseID:XB-GENE-989270 Length:387 Species:Xenopus tropicalis


Alignment Length:256 Identity:168/256 - (65%)
Similarity:206/256 - (80%) Gaps:0/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFFDRHYQRGLRWYRHHMPYTIEGQITM 192
            |::||..:||||||.||||||||:|:|||:||.|:|.|||||:|.:||.|||..||.|::|||||
 Frog   130 SKNLPQAIIIGVKKGGTRALLEFLRIHPDIRAVGAEPHFFDRNYHKGLDWYRDLMPRTLDGQITM 194

  Fly   193 EKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSV 257
            |||||||||||.|.|:..|:...||::||||||||.||||||..||:.|:..||.|.|.|.:..:
 Frog   195 EKTPSYFVTKEAPARISAMSKDAKLIVVVRDPVTRVISDYTQTLSKRPDIPTFESLTFKNRTTGL 259

  Fly   258 VDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYF 322
            :|.:|..::||:||::||.|||.||:.|:||:||||||.|||.|:|||||||||||::|:|||||
 Frog   260 IDISWSAIQIGIYAKHLENWLLDFPIGQMLFVSGERLITDPAGELGRVQDFLGLKRIITDKHFYF 324

  Fly   323 NATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLTGINFAW 383
            |.|||||||.|:|..|.||||||||||.||.|.|..::||||||||||.||||:||.:|.|
 Frog   325 NKTKGFPCLKKAEGSSKPHCLGKTKGRTHPDIHPKVVQRLREFYRPFNMKFYQMTGQDFGW 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 155/236 (66%)
hs3st3a1XP_002941135.1 Sulfotransfer_1 133..374 CDD:366246 159/240 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 344 1.000 Domainoid score I1050
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 373 1.000 Inparanoid score I2064
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378919at33208
OrthoFinder 1 1.000 - - FOG0000744
OrthoInspector 1 1.000 - - otm48693
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3982
SonicParanoid 1 1.000 - - X411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.