DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and ndst4

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031758874.1 Gene:ndst4 / 100380006 XenbaseID:XB-GENE-951845 Length:873 Species:Xenopus tropicalis


Alignment Length:315 Identity:105/315 - (33%)
Similarity:145/315 - (46%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PPAQTVTSSLDGAPKYQLLRQQGLRP--------SRH------------LPDTLIIGVKKSGTRA 146
            ||.|.       |.||..|.|:...|        .||            ||..|:||.:|:||.|
 Frog   553 PPIQL-------AHKYFDLFQEQRDPLWQNPCDDRRHRDIWSRDKTCERLPKFLVIGPQKTGTTA 610

  Fly   147 LLEFIRLHPDVRA------AGSEVHFFD-RHYQRGLRWYRHHMPY--TIEGQITMEKTPSYFVTK 202
            |..|:.:||::.:      ...||.||. .:|.:|:.||....||  ........||:.:||.::
 Frog   611 LYLFLLMHPNIISNFANPKTFEEVQFFSGNNYHKGIDWYMDSFPYPSNTTSDFLFEKSANYFHSE 675

  Fly   203 EVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNGSYSVV--DTNWGPV 265
            |||:|...:.|..||:.::.||..||.|.|....|.|....|  :.:|    |.|:  |.| .|:
 Frog   676 EVPKRAAALLPKAKLITILIDPSDRAYSWYQHQRSHKDPAAL--KFSF----YEVISADQN-APL 733

  Fly   266 KI----------GVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHF 320
            ::          |.||.::||||.|||.||||.|.|:.|..:||..:..||.|||    |...:.
 Frog   734 ELQMLQRRCLVPGWYASHIERWLAYFPPSQLLIIDGQHLRSEPATVMDEVQKFLG----VFPHYN 794

  Fly   321 Y-----FNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFN 370
            |     |:..|||.|....|.::  .||||.|||.:|.:|..|...|..:|:..|
 Frog   795 YSDALTFDPQKGFWCQLLEEGKT--KCLGKNKGRKYPTMDLEARAFLSTYYQDHN 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 93/262 (35%)
ndst4XP_031758874.1 HSNSD 20..506 CDD:403326
Sulfotransfer_1 595..846 CDD:395556 93/263 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.