DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and ndst3

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_009305879.1 Gene:ndst3 / 100317129 ZFINID:ZDB-GENE-090312-199 Length:874 Species:Danio rerio


Alignment Length:360 Identity:102/360 - (28%)
Similarity:156/360 - (43%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SNLRNLLALTSSPRNETNNAANSSSSNSSSSRNSSSTTGAPPAQTVTSSLDGAPKYQLLRQQGLR 126
            :||.|.|...::.|..|                      .||.|.       |.||..|..:...
Zfish   536 TNLANFLKCWTNLRLHT----------------------LPPLQL-------AHKYFTLFPEQRN 571

  Fly   127 P--------SRH------------LPDTLIIGVKKSGTRALLEFIRLHPDVRA------AGSEVH 165
            |        .||            ||..:::|.:|:||.||..|:.:||.:.:      ...||.
Zfish   572 PLWQNPCDDKRHKDIWSKEKTCDRLPKFMVVGPQKTGTTALYLFLIMHPFISSNFPSVKTFEEVQ 636

  Fly   166 FFD-RHYQRGLRWYRHH--MPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTR 227
            ||: .:|.:|:.||...  :|..:......||:.:||.::|.|:|...:.|..|:|.::.:|..|
Zfish   637 FFNTNNYHKGIDWYMEFFPVPSNVSTDFLFEKSANYFPSEETPKRAAALLPKAKILTLLINPSDR 701

  Fly   228 AISDYTQAASKKADMKLFEQLAFVNGSYSVVDT-NWGPVKI----------GVYARYLERWLLYF 281
            |.|.|....:.:....|  |.:|    |.|:.. |..|.::          |:||.:|||||.|:
Zfish   702 AYSWYQHQRAHEDPAAL--QFSF----YEVISADNQAPPELRSLQNRCLIPGLYATHLERWLTYY 760

  Fly   282 PLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTEKHFY-----FNATKGFPCLFKSEARSTPH 341
            |.:||:.|.|::|..|||..:..:|.|||    ||..:.|     |:..|||.|......|:  .
Zfish   761 PPNQLMIIDGQQLRNDPAKVMDELQKFLG----VTPYYNYSQALTFDPQKGFWCQLLEGGRT--K 819

  Fly   342 CLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQL 376
            ||||:|||.:..:|..:...|..:||..|.:..:|
Zfish   820 CLGKSKGRKYSPMDSESRAFLSRYYRDQNIELSKL 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 83/261 (32%)
ndst3XP_009305879.1 HSNSD 20..507 CDD:288882
Sulfotransfer_1 596..845 CDD:279075 82/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.