DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and hs3st5

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001120624.1 Gene:hs3st5 / 100145790 XenbaseID:XB-GENE-5795358 Length:345 Species:Xenopus tropicalis


Alignment Length:267 Identity:122/267 - (45%)
Similarity:170/267 - (63%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 RHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFF--DRHYQRGLRWYRHHMPYTIEGQIT 191
            :.||..:||||:|.|||||||.:.|||.|..|..|:|||  |.:|.:|:.|||..||::...|.|
 Frog    87 QQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYAKGIEWYRKKMPFSHPHQTT 151

  Fly   192 MEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAAS----KKADMKLFEQLAFVN 252
            :||:|:||:|.|||:|:|.||.:.||||:||:|.|||||||||...    |......||::| ::
 Frog   152 IEKSPAYFITDEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKMA-MD 215

  Fly   253 GSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVTE 317
            .:...|:|.:..|:..:|.::|||||.|||:.|...:.|:|||.:|..|:..|:.||.|...:::
 Frog   216 SNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITEPLPELQLVEKFLNLPPRISQ 280

  Fly   318 KHFYFNATKGFPCL-----FKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLT 377
            .:.|||:|:||.||     |..       ||..:|||.||.:||..|.:|.:|:.|||.||||:|
 Frog   281 YNLYFNSTRGFYCLRFNIVFNK-------CLAGSKGRIHPEVDPSVITKLHKFFHPFNQKFYQIT 338

  Fly   378 GINFAWP 384
            |..|.||
 Frog   339 GRTFNWP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 110/247 (45%)
hs3st5NP_001120624.1 Sulfotransfer_1 89..329 CDD:366246 110/247 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.