DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7889 and Mettl21a

DIOPT Version :10

Sequence 1:NP_573368.2 Gene:CG7889 / 32916 FlyBaseID:FBgn0031003 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_080240.1 Gene:Mettl21a / 67099 MGIID:1914349 Length:218 Species:Mus musculus


Alignment Length:162 Identity:51/162 - (31%)
Similarity:75/162 - (46%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 WEAALALGDYLLQHRDLVRGKNIVELGAGAGLLGIMLKLPALQLQVGQVLLTDGSEPCVQLMREN 195
            |:||:.|..||......:||.:.||||||.||:||:..|..     .||.:|| .:..::.::.|
Mouse    47 WDAAVVLSMYLEMGAVELRGCSAVELGAGTGLVGIVAALLG-----AQVTITD-RKVALEFLKSN 105

  Fly   196 ISLNFPD--TPKEQMPQAEQLNWAAVSEFPWDSHAKT------DLLIAADVIYDDSQFDALLGAM 252
            :..|.|.  .||           |.|.|..|..:.::      ||::.|||||.:..|..||..:
Mouse   106 VEANLPPHIQPK-----------AVVKELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTL 159

  Fly   253 DYLYSRRGGGLETLLASTVRNVDTLHKFMTQL 284
            .:|.|...   ..|||..:| .:....|:|.|
Mouse   160 GHLCSNNS---VILLACRIR-YERDSNFLTML 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7889NP_573368.2 FAM86 8..83 CDD:464362
AdoMet_MTases 112..>249 CDD:473071 40/125 (32%)
Mettl21aNP_080240.1 Methyltransf_16 25..190 CDD:313513 51/162 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.