DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7889 and CG5013

DIOPT Version :10

Sequence 1:NP_573368.2 Gene:CG7889 / 32916 FlyBaseID:FBgn0031003 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650520.1 Gene:CG5013 / 41951 FlyBaseID:FBgn0038396 Length:247 Species:Drosophila melanogaster


Alignment Length:147 Identity:43/147 - (29%)
Similarity:66/147 - (44%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EGTTGLCTWEAALALGDYLLQHRDLVRGKNIVELGAGAGLLGIMLKLPALQLQVGQVLLTDGSEP 187
            :|.....||..|..|..:|.:.|..:.||.|:|||:|..|.||:    |.:.: .||:|||.   
  Fly    46 QGAYSFYTWPCAPILAHFLWERRQTLAGKRILELGSGTALPGIL----AAKCR-AQVVLTDN--- 102

  Fly   188 CVQLMRENISLNFPDTPKEQMPQAE----QLNWA----AVSEFPWDSHAKTDLLIAADVIYDDSQ 244
            |: |.:....:.......:..|..:    .|:|.    :|...|     ..||:||||..||.|.
  Fly   103 CI-LPKSLAHIRKSCLANQLQPGVDIDVVGLSWGLLLNSVFRLP-----PLDLIIAADCFYDPSV 161

  Fly   245 FDALLGAMDYLYSRRGG 261
            |:.::..:.:|..|..|
  Fly   162 FEDIVVTVAFLLERNAG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7889NP_573368.2 FAM86 8..83 CDD:464362
AdoMet_MTases 112..>249 CDD:473071 40/133 (30%)
CG5013NP_650520.1 Nnt1 <54..>165 CDD:443104 38/124 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.