DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7889 and CG10584

DIOPT Version :10

Sequence 1:NP_573368.2 Gene:CG7889 / 32916 FlyBaseID:FBgn0031003 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_649278.1 Gene:CG10584 / 40324 FlyBaseID:FBgn0037045 Length:274 Species:Drosophila melanogaster


Alignment Length:169 Identity:52/169 - (30%)
Similarity:78/169 - (46%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GLCTWEAALALGDYLLQHRDLVRGKNIVELGAGAGLLGIMLKLPALQLQVGQVLLTDGSEPCV-Q 190
            ||..|..||.|.|||...:|....|.::|||||.||..|...:.    ..|::..||....|: :
  Fly    71 GLQVWRGALLLADYLFSKKDEFSQKTLMELGAGVGLTSIAAGIH----NNGRIYCTDVDLGCILK 131

  Fly   191 LMRENISLNFPDTPKEQMPQAEQLNWAAVSEFPWD------SHAK--------TDLLIAADVIYD 241
            |:|.|:..|            .:|..|.:|...:|      .|::        :|:::||||||.
  Fly   132 LIRGNVQRN------------SKLLRATISVLEFDFLASKEDHSQDLLEAIDNSDIILAADVIYC 184

  Fly   242 DSQFDALLGAMDYLY--SRRGGGLETL-LASTVRNVDTL 277
            |:..||.:..:|.|.  .|:.|..:|: :|...|.|.||
  Fly   185 DTLTDAFICVLDNLLDRGRQTGRPKTIYMALEKRYVFTL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7889NP_573368.2 FAM86 8..83 CDD:464362
AdoMet_MTases 112..>249 CDD:473071 42/136 (31%)
CG10584NP_649278.1 AdoMet_MTases 70..219 CDD:473071 48/163 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.