DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7889 and Vcpkmt

DIOPT Version :10

Sequence 1:NP_573368.2 Gene:CG7889 / 32916 FlyBaseID:FBgn0031003 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_036013188.1 Gene:Vcpkmt / 207965 MGIID:2684917 Length:265 Species:Mus musculus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:65/159 - (40%) Gaps:41/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GTTGLCTWEAALALGDYL------------LQHRDLVRGKNIVELGAGAGLLGIMLKLPALQLQV 176
            |..|...|:||:.|..||            |..|      :::|||:|.|.:|:|    |..|. 
Mouse    68 GGVGCVVWDAAIVLSKYLETPGFSGDGAHALSRR------SVLELGSGTGAVGLM----AATLG- 121

  Fly   177 GQVLLTDGSEPCVQLMRENISLNFPDTPKEQMP---QAEQLNWAAVSEFPWDSHAKTDLLIAADV 238
            ..|::|| .|....|::.||.:|     |..:.   ||:.|.|....|    .....|.::.||.
Mouse   122 ADVIVTD-LEELQDLLKMNIDMN-----KHLVTGSVQAKVLKWGEDIE----DLMSPDYILMADC 176

  Fly   239 IYDDSQFDALLGAMDYLYSRRGGGLETLL 267
            ||.:...:.||..:..|     .|.||.:
Mouse   177 IYYEESLEPLLKTLKDL-----SGSETCI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7889NP_573368.2 FAM86 8..83 CDD:464362
AdoMet_MTases 112..>249 CDD:473071 38/139 (27%)
VcpkmtXP_036013188.1 Methyltransf_16 54..226 CDD:313513 44/159 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.