DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and AIP5

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_116671.1 Gene:AIP5 / 850570 SGDID:S000001912 Length:1233 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:66/295 - (22%)
Similarity:93/295 - (31%) Gaps:100/295 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RDDSNIENPTIPP---SNLDESTTEKP-------ATEAPGTTEKVTTAAPGTTEKVTTEAPGTTE 135
            ::|..:.:..:.|   :.::.|..|.|       :||...||:|.......||.....|.|...|
Yeast   699 KEDVRVPDEDVKPEIATTIENSEEEDPKSQRVQISTEQAETTQKDMGDVGSTTSFKEEEKPKRFE 763

  Fly   136 KITTEAPGTTEKIT-------TEAP---------GTTEKITTEAPGTTEKITTEAPGTTEKPAT- 183
             ||.|....|.|.|       |||.         ||.||....:..:.:|.|.|.........| 
Yeast   764 -ITQEGDKITGKDTNHEHGEATEAASENSKASDVGTAEKYIEPSSESVKKDTEEDAEVENSEKTE 827

  Fly   184 -----------DAPGTTEKPA------------TDAPGTTEKSETT------------DAPGTTD 213
                       |||...|..|            |:.....|.||.|            |||    
Yeast   828 FIKVKAELENLDAPKEAEVTAELNKENEDVEVDTEEDAEVENSEKTEFIKVKAELGNLDAP---- 888

  Fly   214 KSDTDAPIT-------DEPSTAETSTDEPNTETTESGEETTIEDNVCATTGLFPTGSCTHFIVC- 270
               .:|.:|       ::...|.||.::..|:.:|.. ||.|||           |:||...|. 
Yeast   889 ---KEAEVTAELNKENEDVEVAATSKEDIETKCSEPA-ETPIED-----------GTCTEAEVSK 938

  Fly   271 ----------SYAEGDELKAYTKKCPGEMQFDPFN 295
                      ...|..::....|...|:.:.|..|
Yeast   939 KDAEAVTKEDENMENSKIAEALKDVTGDQEIDDIN 973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 31/121 (26%)
AIP5NP_116671.1 2A1904 <271..>528 CDD:273344
PTZ00121 <482..1082 CDD:173412 66/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.