DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Rp1

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_008761780.1 Gene:Rp1 / 681377 RGDID:1596713 Length:2150 Species:Rattus norvegicus


Alignment Length:184 Identity:46/184 - (25%)
Similarity:63/184 - (34%) Gaps:40/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PSNLDESTTEKPATEAPGTTEKVTTAAPGTTEK---VTTEAP-GTTEKITTE-----------AP 142
            |.|.|......| .:.||.:.:|........||   .|...| ..|:.:.:|           ||
  Rat   257 PGNYDIQKYLLP-VKLPGISHRVHRKGKAKIEKRKMSTHSVPRPQTDSLASEKTYDCFSDFSVAP 320

  Fly   143 GTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTE---------KPATDAPGTTEKPATDAPG 198
            .....:.|....|.....:| .|..:.|.....||..         |..| ...||.....|...
  Rat   321 ENYLALETHDSQTLSTYPSE-DGVEKSIVFNQDGTMTVVMKVRFKIKEET-VKWTTTVNRADLSN 383

  Fly   199 TTEKSETTDAPG-TTDKSDT---------DAPITDEPSTAETS-TDEPNTETTE 241
            ..|||:.:..|| |.|:|.:         ...|||  :|.:.| |:|.||:.||
  Rat   384 DDEKSKISSYPGKTEDRSSSLKLVVPCSLSEDITD--TTQQGSLTEEENTQMTE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 20/98 (20%)
Rp1XP_008761780.1 DCX 60..135 CDD:176357
DCX 182..257 CDD:176357 46/184 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.