DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and CG1647

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:275 Identity:56/275 - (20%)
Similarity:90/275 - (32%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IPPSNLDESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTEKI----TTEAPGTTEKITTE 151
            :||..|...::.|........|| |:||.|      .:|.|..|..:    .:||...:..||..
  Fly   845 LPPLELQNESSRKDLESERMDTE-VSTALP------ASETPSQTRDVLGVEKSEASAFSLVITNI 902

  Fly   152 APGTTEKITTEAPGTTEKITTEAPGTTEKPATDAPGTTEKPATDAPGTTEKSETTDAPGTTDKSD 216
            ......:.:.......|.....:|.||.:|.:......:.||.|.       :|:.......:|.
  Fly   903 CSQAVPQPSAACSNDIECSIGPSPSTTNEPHSHTVENVQSPANDL-------QTSAQVAIAAQSQ 960

  Fly   217 TDAPITDEP-----STAETSTDEP--------NTETT-----ESGEETTIEDNV----------C 253
            .|..|..:|     |.|:|....|        |||:.     ...|:.:||::.          |
  Fly   961 PDPCIVSQPAASSESQADTKDLPPAASQIQTFNTESLPIHVHSETEDNSIENDASYLESRAQVDC 1025

  Fly   254 ATTGL------------FPTGSCTHFIVCSYAEGD--------------ELKAYTKKCPGEMQFD 292
            .:.|.            .|:|||...|..:.:.|:              |:.|.:..|...:..|
  Fly  1026 QSAGTENPSVVLEQNESLPSGSCVSPIPENPSPGNSPPQHDESESLDKPEMAAGSAYCLATVSLD 1090

  Fly   293 -PFNSVCSASYDCTA 306
             |.::...|...|.|
  Fly  1091 APKDTEALALPPCDA 1105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 19/89 (21%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.