DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Lmpt

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster


Alignment Length:138 Identity:27/138 - (19%)
Similarity:50/138 - (36%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 APGTTEKVTTEAPGTTEKITTEAPGTTEKITTEAPGTTE--KITTEAPGTTEKITTEAPGTTEKP 181
            :|....:.|.|:..:.|.:..|:.....::..|....||  |.........|:|..|.|...|  
  Fly   571 SPAKDVRPTAESTTSLEMLGEESTNPWGEVVPEHYKDTEFWKREKALSIDEEEIELERPSRGE-- 633

  Fly   182 ATDAPGTTEKPATDAPGTTEKSETTDAPGTTDKSDTDAPITDEPSTAETSTDEPNTETTESGEET 246
                  ..|:.||:.|.::...|.|:|......:.....::.|....|...|.|....|....::
  Fly   634 ------DVEEEATNEPKSSSFEEATEAQNEQAVAALKQQLSKEQLDKEAEKDNPQAVDTSDSNKS 692

  Fly   247 TIEDNVCA 254
            .::.::.|
  Fly   693 NLQTSIAA 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 13/59 (22%)
LmptNP_996113.2 GBP_C <103..201 CDD:303769
ARGLU 110..255 CDD:291991
coiled coil 170..181 CDD:293879
coiled coil 190..201 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.