DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Su(var)2-HP2

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610972.2 Gene:Su(var)2-HP2 / 36621 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster


Alignment Length:195 Identity:46/195 - (23%)
Similarity:69/195 - (35%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NLDESTTEKPATEAPGTTEKVTTAAPGTTEKV-------TTEAPGTTEKITTEAPGTTEKITTEA 152
            |...:..||.|....|..|.|.... |...|:       |.|...|.|.:.|..|.:.:  |::.
  Fly   498 NRGATMEEKSANCRDGEGEPVKRKR-GRPRKIIPKEEAKTAETENTIESLNTNVPLSID--TSKE 559

  Fly   153 PGTTEKITTEAPGTTEKITT------EAPGTTEKPATDAPGTTEKPATD---APG--TTEKSETT 206
            ...||.:..|.|...:::.:      |..|:|..|..|....:....||   ||.  ..:|||:|
  Fly   560 NPETETVNLEVPIKQDELVSDLDNAKELTGSTNLPQDDIEMASNHQETDLKCAPDRVALDKSEST 624

  Fly   207 -----------DAPGTT--DKSDTDAPITD-------EPSTAETSTDEPNTETTESGEETTIEDN 251
                       |.|..|  |:|.......:       :....||..:.||..:.|:.|.:.|..|
  Fly   625 PKVEEEQLCKVDTPSDTALDESKVSESAKNHIELEDKDKDKEETQKESPNGNSKETNENSVIVTN 689

  Fly   252  251
              Fly   690  689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 21/94 (22%)
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596 22/94 (23%)
PTZ00449 <739..1091 CDD:185628
PTZ00108 <1132..1374 CDD:240271
PTZ00121 <1720..>2291 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.