DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and IBSP

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:270 Identity:59/270 - (21%)
Similarity:92/270 - (34%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTMLMGLALILAPSTIQAKSLCRSSGYFALVDNTPDFYACQSTAYGGYSLRFLRCPAGLVFSSSM 68
            |..::|:|...:...:..:.....|....:....|.:|..:...:..:..||   |......||.
Human     7 LLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRF---PVQGSSDSSE 68

  Fly    69 AQCVQSIAAFEARDDSNIENPTIPPSNLDESTTEKPATEAPGTTEKVTT------AAPGT----- 122
            .....|....|..::::.|......||.||.      :||..||...||      |.|||     
Human    69 ENGDDSSEEEEEEEETSNEGENNEESNEDED------SEAENTTLSATTLGYGEDATPGTGYTGL 127

  Fly   123 -TEKVTTEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPATDAP 186
             ..::..:|...|.|.|.|.....|:...|.....|:...|.....:.|...:..:||  |.:..
Human   128 AAIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTE--AENGN 190

  Fly   187 GTT---------EKPATDAPGTTEKSETTDAPGTTDKSDTDAPITDEPSTAETSTDEPNTETTES 242
            |::         |:..|.|     .:|.|...|...|..:..  |..|:.....|..|....|.|
Human   191 GSSGGDNGEEGEEESVTGA-----NAEDTTETGRQGKGTSKT--TTSPNGGFEPTTPPQVYRTTS 248

  Fly   243 ---GEETTIE 249
               |:.||:|
Human   249 PPFGKTTTVE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884 8/45 (18%)
MCLC <77..177 CDD:283562 26/111 (23%)
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 56/260 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 49/213 (23%)
cell-attachment tripeptide 286..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.