DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and HCG22

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001335178.1 Gene:HCG22 / 285834 HGNCID:27780 Length:251 Species:Homo sapiens


Alignment Length:172 Identity:78/172 - (45%)
Similarity:89/172 - (51%) Gaps:14/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DSNIENPTIPPSNLDESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTEKITTEAPGTTEK 147
            ||.|....:   ..|..|||...|..|||||...||.|||||...|..|||||...|..|.||:.
Human    80 DSRIRENDV---TADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTKD 141

  Fly   148 ITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPATDAPGTTEKPATDAPGTTEKSETTDAPGTT 212
            ..:..||||:...|..|||||...|..||||:...|..|.|||...|..||||:.|.|.| ||||
Human   142 YVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVD-PGTT 205

  Fly   213 DKSDTDAP------ITDEPSTAETS-TDEPNT---ETTESGE 244
            :.|.|..|      ||.:|.|.|.| |.:|.|   |||:.|:
Human   206 EDSVTADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 42/93 (45%)
HCG22NP_001335178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..251 78/172 (45%)
LGT <83..248 CDD:320995 76/169 (45%)
15 X 11 AA approximate repeats 153..251 44/96 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto89138
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.