DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Dmp1

DIOPT Version :10

Sequence 1:NP_573365.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001420690.1 Gene:Dmp1 / 25312 RGDID:2508 Length:504 Species:Rattus norvegicus


Alignment Length:145 Identity:35/145 - (24%)
Similarity:58/145 - (40%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPATDAPGTTEKPATD-----APG 198
            ||:..:.|:....|......:.:|   ::|:......|......||:..:.|:..:|     ..|
  Rat    25 TESESSEERTGNLAQSPPPPMNSE---SSEESKVSPEGQANSDHTDSSESGEELGSDRSQYRPAG 86

  Fly   199 TTEKSETTDAPGTTDKSDT-DAPITDE---PSTAE--------TSTDEPNTETTESGEETTIEDN 251
            ...||...||....|:.|: |....||   |...|        ..:||.:.:||:|.|::|.::|
  Rat    87 GLSKSAGMDADKEEDEDDSGDDTFGDEDNGPGPEERQWGGPSRLDSDEDSADTTQSSEDSTSQEN 151

  Fly   252 VCATTGLFPTGSCTH 266
            ....|   |:.|..|
  Rat   152 SAQDT---PSDSKDH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_573365.1 CBM_14 26..72 CDD:426342
motB <90..208 CDD:183756 14/73 (19%)
Dmp1NP_001420690.1 DMP1 1..504 CDD:462128 35/145 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.