DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Dmp1

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001345942.1 Gene:Dmp1 / 13406 MGIID:94910 Length:503 Species:Mus musculus


Alignment Length:149 Identity:36/149 - (24%)
Similarity:62/149 - (41%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPA----TDAPGTTEKPATD---- 195
            ||:..:.|:       |.:...:..|.|..:.:.|:..:.|..|    ||:..:.|:...|    
Mouse    25 TESESSEER-------TGDLAGSPPPPTNSESSEESQASPEGQANSDHTDSSESGEELGYDRGQY 82

  Fly   196 -APGTTEKSETTDAPGTTDKSDT-DAPITDEPS-----------TAETSTDEPNTETTESGEETT 247
             ..|...||..|.|....|:.|: |....||.:           .::..:||.:|:||:|.|::|
Mouse    83 RPAGGLSKSTGTGADKEDDEDDSGDDTFGDEDNDLGPEEGQWGGPSKLDSDEDSTDTTQSSEDST 147

  Fly   248 IEDNVCATTGLFPTGSCTH 266
            .::|....|   |:.|..|
Mouse   148 SQENSAQDT---PSDSKDH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 7/37 (19%)
Dmp1NP_001345942.1 DMP1 1..503 CDD:311295 36/149 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..503 36/149 (24%)
Cell attachment site. /evidence=ECO:0000255 350..352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.