DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and Dmp1

DIOPT Version :10

Sequence 1:NP_573365.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_058059.2 Gene:Dmp1 / 13406 MGIID:94910 Length:503 Species:Mus musculus


Alignment Length:149 Identity:36/149 - (24%)
Similarity:62/149 - (41%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPA----TDAPGTTEKPATD---- 195
            ||:..:.|:       |.:...:..|.|..:.:.|:..:.|..|    ||:..:.|:...|    
Mouse    25 TESESSEER-------TGDLAGSPPPPTNSESSEESQASPEGQANSDHTDSSESGEELGYDRGQY 82

  Fly   196 -APGTTEKSETTDAPGTTDKSDT-DAPITDEPS-----------TAETSTDEPNTETTESGEETT 247
             ..|...||..|.|....|:.|: |....||.:           .::..:||.:|:||:|.|::|
Mouse    83 RPAGGLSKSTGTGADKEDDEDDSGDDTFGDEDNDLGPEEGQWGGPSKLDSDEDSTDTTQSSEDST 147

  Fly   248 IEDNVCATTGLFPTGSCTH 266
            .::|....|   |:.|..|
Mouse   148 SQENSAQDT---PSDSKDH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_573365.1 CBM_14 26..72 CDD:426342
motB <90..208 CDD:183756 17/77 (22%)
Dmp1NP_058059.2 DMP1 1..503 CDD:462128 36/149 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..503 36/149 (24%)
Cell attachment site. /evidence=ECO:0000255 350..352
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.